PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_908g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 309aa    MW: 34232.1 Da    PI: 8.5726
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_908g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.77.5e-101964346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      WT e  +++ +a + + ++   +W+++a++++ g+t+ +++ ++ +
      MA_908g0010 19 VWTLEQNKRFENALADFDKDtpdRWDKVAARLP-GKTATDVRKHYED 64
                     6********************************.***********76 PP

2Myb_DNA-binding37.94e-12127171347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + +  G+g W++I+r +   Rt+ q+ s+ qky
      MA_908g0010 127 PWTEEEHRQFLMGLHNIGKGYWRSISRNFVVSRTPTQVASHAQKY 171
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.2E-81668IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-41866IPR009057Homeodomain-like
SuperFamilySSF466891.36E-111873IPR009057Homeodomain-like
PfamPF002491.0E-71965IPR001005SANT/Myb domain
CDDcd001673.68E-72066No hitNo description
PROSITE profilePS500906.9112066IPR017877Myb-like domain
PROSITE profilePS5129416.719120176IPR017930Myb domain
SuperFamilySSF466891.58E-15121174IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-16123174IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-10124171IPR009057Homeodomain-like
SMARTSM007173.6E-8124174IPR001005SANT/Myb domain
CDDcd001671.48E-6127172No hitNo description
PfamPF002496.1E-10127171IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MWEMDLPSQG TSLSSSGSVW TLEQNKRFEN ALADFDKDTP DRWDKVAARL PGKTATDVRK  60
HYEDLVDDVT CIEAGCVALP TYSNSSCTLE WIEGKSGDMH GLKQQFGSGG RGSSTKPSEQ  120
ERKKGVPWTE EEHRQFLMGL HNIGKGYWRS ISRNFVVSRT PTQVASHAQK YFSRLCLDNK  180
NKRRSSIHDI TTVNGTDRRS FPLPQASTRQ TNSPPTPAEI NQSPCLTYPS PILRGPLISS  240
LGSQADGNPL FSSHYPLSLY TQRGFGGHSP RTFIPDSSIA SGVHYRDVEL STASYHRCTD  300
AAFSQLKGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-171285376RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1070220.0BT107022.1 Picea glauca clone GQ03101_N16 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429310.17e-82hypothetical protein CICLE_v10012285mg
RefseqXP_006480971.18e-82PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H74e-76DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D6R2Q12e-90A0A0D6R2Q1_ARACU; Uncharacterized protein
STRINGPOPTR_0001s25590.11e-78(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.14e-75MYB family protein